PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0032s0540.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 1717aa    MW: 192784 Da    PI: 5.7105
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0032s0540.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-192883257
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                             kR+  t+ ql++Le++++ + yps+e+r+eL++klgL++rq ++WF+ rR k+kk
  SapurV1A.0032s0540.2.p 28 PKRQMKTPFQLQTLEKAYATDTYPSEEMRAELSDKLGLSDRQLQMWFCHRRLKDKK 83
                            69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-19884IPR009057Homeodomain-like
SuperFamilySSF466898.55E-171984IPR009057Homeodomain-like
PROSITE profilePS5007117.0862484IPR001356Homeobox domain
SMARTSM003899.9E-202688IPR001356Homeobox domain
PfamPF000464.7E-172883IPR001356Homeobox domain
CDDcd000863.58E-152984No hitNo description
SMARTSM005714.0E-21515574IPR018501DDT domain
PROSITE profilePS5082716.539515574IPR018501DDT domain
PfamPF027911.0E-16516571IPR018501DDT domain
PfamPF050665.5E-15697765IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.4E-6905949IPR028942WHIM1 domain
PfamPF156139.0E-1310881160IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1717 aa     Download sequence    Send to blast
MEEANSEGEN HSKSKSNALN SNEDQGKPKR QMKTPFQLQT LEKAYATDTY PSEEMRAELS  60
DKLGLSDRQL QMWFCHRRLK DKKETPVKQR KAAPLHESPL EDMRIVGADS GSDYGSGSAS  120
GSSPLSESRK VVLDDGHTMK RYYESSPRSV MELRAIACVE AQLGEPLRED GPILGMKFDS  180
LPPDAFGEPI AAITEQPKRM GYSYEDKVYE RRDAKSSKDP AITRSDTYGP HIQSPYHDSP  240
VDTLRGRASP FGVGQTPHAR LLSQQDKSGH VFLSPQRDDD YLLQQDTFTN NRTSAQSISH  300
PIMGPENSNV FSDAQTFHND TELQLERKRR IDEPRTSREV EAYEIRIRKE LEKQDILRRK  360
NEERMRKEME RHDRERRKEE ERSMRDRQRE EERLLREQKR ELERREKFMQ KEYLKAEKIR  420
QKEELRREKE AVKRKAAMEK ATARKIAKDS LDLIEDEQLE LMELTAASKG LASIVNLDYD  480
TLQNLDSFRD MLITFPSEAV QLKKSFGFQP WLDSEENIGN LLMVWKFFIT FADVLGLWPF  540
TLNEFVQAFH DYDSRLLGEL HVALLKLIIK DIEDVARTPS SGLGINQYYT ANPEGGHPQI  600
VQGAYTWGFD IRNWQQHLNS LTWPEILRQL ALSAGFGPRL KKKSTTWAGL GDIDEVKDCE  660
DIVSIIRNGS AAENAFALMR EKGLLLPRRS RHRLTPGTVK FAAFHVLSLE GSKGLTVLEL  720
ADKIQKSGLR DLTTSKTPEA SISVALTRDQ KLFERIAPST YCARAAFRKD PADAEAILAE  780
ARKKIRIFEN GFLGGENADD VERDEDSEGD ADEDPEVDDL ATPVSSNKST VHSGKVNALS  840
GSGSGKVSND TSSTVQHKCE KGLSSFSLNG PKDAVAPSII EQCVTHKNEG TNNADEENIE  900
IDESNSGESW IQGLTEGEYS HLSVEERLSA LVVLVGISNE GNTIRAVLED RLEAANVLKK  960
QMWGEAQLDR SRLKEEFISK LDFPTFTGSK VETQVASSAV EGSQSPLVLA DGKSKEASPS  1020
NTEDQKSLPE DAENNVSCAL SEKALVIQDL SMNPDNISAQ QHGYASKRSR SQLKAYIAHL  1080
AEEMYIYRSL PLGQDRRRNR YWQFVASASR NDPCSGRIFV ELHNGSWRVI DSEEAFDTFL  1140
SSLDTRGIRE SHLCIMLQKI ESSFKENVRR NLGTANIVCQ SGTTDEKETA ETDTANCSAG  1200
NSPGSTVCVS SSDTLDAFSL FSIELGRNSA EKKGSLKRYQ DFQNWVWKEC FNSSTLRAMK  1260
YGNKRCEQLL DTCDLCLDTY LSEDTHCLSC HKTFKFENKK FDFAEHEIQC KVKRKIDPGN  1320
ACTCDSSLPP GTRLLTALLS CIEVSVPQEA LESFWMGIPR KDWGMKLAMP SSTEELLQIL  1380
TVFESAIKRE RLSSNFETTK ELLGSSALVG SAAHDSASLG LVSVLPWMPK TTAAVALRLF  1440
ELDASIIYVK EEKPEPSADK PVKLYMKLSS RYSPFKNEEV ELKDVKHEEH IKEDIVDLRG  1500
KQSSHKRGRG GRDQGPATKG QRRMPGLKSD TGKQRSRGIQ NLNQGPRQQG KKTNLQATSR  1560
GRRTVRKRRV EKMQPKEPLV GQMTGMASSM SYLSKKTAVH NRYVKSFRNL GDEDWSVKKG  1620
RVNGDENSNM MEEAESDDNA EELYGKGNWK PGGSNGWNRN SMEASDDDEN ASNGIEAMRD  1680
DDSEGDMEMS DGSDRAAANR VQNDGVDSAD SDEYSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17683RRLKDKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001229.10.0PREDICTED: uncharacterized protein LOC105108578 isoform X2
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLU5G1470.0U5G147_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05660.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1